Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) |
Family a.4.13.1: Sigma3 domain [88660] (3 proteins) |
Protein Sigma70 [88661] (1 species) |
Species Thermus thermophilus [TaxId:274] [88662] (11 PDB entries) Uniprot Q9WX78 |
Domain d2a6hp1: 2a6h P:258-318 [126277] Other proteins in same PDB: d2a6ha1, d2a6ha2, d2a6hb1, d2a6hb2, d2a6hc_, d2a6hd_, d2a6he_, d2a6hf2, d2a6hf3, d2a6hk1, d2a6hk2, d2a6hl1, d2a6hl2, d2a6hm_, d2a6hn_, d2a6ho_, d2a6hp2, d2a6hp3 automated match to d1smyf1 protein/RNA complex; complexed with mg, std, zn |
PDB Entry: 2a6h (more details), 2.4 Å
SCOPe Domain Sequences for d2a6hp1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a6hp1 a.4.13.1 (P:258-318) Sigma70 {Thermus thermophilus [TaxId: 274]} iripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwdakrveetlkiaqepvsl e
Timeline for d2a6hp1: