Lineage for d2a6hn_ (2a6h N:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2574250Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 2574251Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 2574346Family e.29.1.2: RNA-polymerase beta-prime [64490] (4 proteins)
  6. 2574381Protein RNA-polymerase beta-prime [64493] (2 species)
  7. 2574387Species Thermus thermophilus [TaxId:274] [75610] (15 PDB entries)
    Uniprot Q8RQE8; part of multichain biological unit
  8. 2574395Domain d2a6hn_: 2a6h N: [126275]
    Other proteins in same PDB: d2a6ha1, d2a6ha2, d2a6hb1, d2a6hb2, d2a6hc_, d2a6he_, d2a6hf1, d2a6hf2, d2a6hf3, d2a6hk1, d2a6hk2, d2a6hl1, d2a6hl2, d2a6hm_, d2a6ho_, d2a6hp1, d2a6hp2, d2a6hp3
    automated match to d1smyd_
    protein/RNA complex; complexed with mg, std, zn

Details for d2a6hn_

PDB Entry: 2a6h (more details), 2.4 Å

PDB Description: Crystal structure of the T. thermophilus RNA polymerase holoenzyme in complex with antibiotic sterptolydigin
PDB Compounds: (N:) DNA-directed RNA polymerase beta' chain

SCOPe Domain Sequences for d2a6hn_:

Sequence, based on SEQRES records: (download)

>d2a6hn_ e.29.1.2 (N:) RNA-polymerase beta-prime {Thermus thermophilus [TaxId: 274]}
kkevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecacg
kykrqrfegkvcercgvevtksivrryrmghielatpaahiwfvkdvpskigtlldlsat
eleqvlyfskyivldpkgailngvpvekrqlltdeeyrelrygkqetyplppgvdalvkd
geevvkgqelapgvvsrldgvalyrfprrvrveyvkkeraglrlplaawvekeaykpgei
laelpepylfraeeegvvelkeleegaflvlrredepvatyflpvgmtplvvhgeivekg
qplaeakgllrmprqvraaqveaeeegetvyltlflewtepkdyrvqphmnvvvpegarv
eagdkivaaidpeeeviaeaegvvhlhepasilvvkarvypfeddvevstgdrvapgdvl
adggkvksdvygrvevdlvrnvvrvvesydidarmgaeaiqqllkeldlealekelleem
khpsrarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdggrfatsdln
dlyrrlinrnnrlkkllaqgapeiiirnekrmlqeavdalldngrrgapvtnpgsdrplr
sltdilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelfkpfllkkm
eekgiapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgiqafqpvlv
egqsiqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspasgeplakp
srdiilglyyitqvrkekkgaglefatpeealaahergevalnapikvagretsvgrlky
vfanpdeallavahgivdlqdvvtvrymgkrletspgrilfarivaeavedekvaweliq
ldvpqeknslkdlvyqaflrlgmektarlldalkyygftfsttsgitigiddavipeekk
qyleeadrkllqieqayemgfltdrerydqilqlwtettekvtqavfknfeenypfnply
vmaqsgargnpqqirqlcglrglmqkpsgetfevpvrssfregltvleyfisshgarkgg
adtalrtadsgyltrklvdvtheivvreadcgttnyisvplfqpdevtrslrlrkradie
aglygrvlarevevlgvrleegrylsmddvhllikaaeageiqevpvrspltcqtrygvc
qkcygydlsmarpvsigeavgivaaqsigepgtqltmrtfhtggvagaaditqglprvie
lfearrpkakaviseidgvvrieeteeklsvfvesegfskeyklpkearllvkdgdyvea
gqpltrgaidphqlleakgpeaverylveeiqkvyraqgvklhdkhieivvrqmmkyvev
tdpgdsrllegqvlekwdvealnerliaegktpvawkpllmgvtksalstkswlsaasfq
ntthvlteaaiagkkdeliglkenvilgrlipagtgsdfvrftqvvdqktlkaieearke
avea

Sequence, based on observed residues (ATOM records): (download)

>d2a6hn_ e.29.1.2 (N:) RNA-polymerase beta-prime {Thermus thermophilus [TaxId: 274]}
kkevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecacg
kykrqrfegkvcercgvevtksivrryrmghielatpaahiwfvkdvpskigtlldlsat
eleqvlyfskyivldpkgailngvpvekrqlltdeeyrelrygkqetyplppgvdalvkd
geevvkgqelapgvvsrldgvalyrfprrvrveyvkkeraglrlplaawvekeaykpgei
laelpepylfgdkivaaidpeeeviaeaegvvhlhepasilvvkarvypfeddvevstgd
rvapgdvladggkvksdvygrvevdlvrnvvrvvesydidarmgaeaiqqllkeldleal
ekelleemkhpsrarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdgg
rfatsdlndlyrrlinrnnrlkkllaqgapeiiirnekrmlqeavdalldngrrgapvtn
pgsdrplrsltdilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelf
kpfllkkmeekgiapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgi
qafqpvlvegqsiqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspa
sgeplakpsrdiilglyyitqvrkekkgaglefatpeealaahergevalnapikvagre
tsvgrlkyvfanpdeallavahgivdlqdvvtvrymgkrletspgrilfarivaeavede
kvaweliqldvpqeknslkdlvyqaflrlgmektarlldalkyygftfsttsgitigidd
avipeekkqyleeadrkllqieqayemgfltdrerydqilqlwtettekvtqavfknfee
nypfnplyvmaqsgargnpqqirqlcglrglmqkpsgetfevpvrssfregltvleyfis
shgarkggadtalrtadsgyltrklvdvtheivvreadcgttnyisvplfqpdevtrslr
lrkradieaglygrvlarevevlgvrleegrylsmddvhllikaaeageiqevpvrsplt
cqtrygvcqkcygydlsmarpvsigeavgivaaqsigepgtqltmrditqglprvielfe
arrpkakaviseidgvvrieeteeklsvfvesegfskeyklpkearllvkdgdyveagqp
ltrgaidphqlleakgpeaverylveeiqkvyraqgvklhdkhieivvrqmmkyvevtdp
gdsrllegqvlekwdvealnerliaegktpvawkpllmgvtksalstkswlsaasfqntt
hvlteaaiagkkdeliglkenvilgrlipagtgsdfvrftqvvdqktlkaieearkeave
a

SCOPe Domain Coordinates for d2a6hn_:

Click to download the PDB-style file with coordinates for d2a6hn_.
(The format of our PDB-style files is described here.)

Timeline for d2a6hn_: