Lineage for d2a6hl2 (2a6h L:50-172)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3004951Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
    unusual fold; contains a left-handed beta-alpha-beta unit
  4. 3004952Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) (S)
    automatically mapped to Pfam PF01000
  5. 3004953Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (3 proteins)
  6. 3004954Protein RNA polymerase alpha subunit [56555] (3 species)
  7. 3004969Species Thermus thermophilus [TaxId:274] [75595] (16 PDB entries)
    Uniprot Q9Z9H6; part of multichain biological unit
  8. 3004985Domain d2a6hl2: 2a6h L:50-172 [126273]
    Other proteins in same PDB: d2a6ha1, d2a6hb1, d2a6hc_, d2a6hd_, d2a6he_, d2a6hf1, d2a6hf2, d2a6hf3, d2a6hk1, d2a6hl1, d2a6hm_, d2a6hn_, d2a6ho_, d2a6hp1, d2a6hp2, d2a6hp3
    automated match to d1smya2
    protein/RNA complex; complexed with mg, std, zn

Details for d2a6hl2

PDB Entry: 2a6h (more details), 2.4 Å

PDB Description: Crystal structure of the T. thermophilus RNA polymerase holoenzyme in complex with antibiotic sterptolydigin
PDB Compounds: (L:) DNA-directed RNA polymerase alpha chain

SCOPe Domain Sequences for d2a6hl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a6hl2 d.181.1.1 (L:50-172) RNA polymerase alpha subunit {Thermus thermophilus [TaxId: 274]}
gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkev
kardflpvadveimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvda
vfs

SCOPe Domain Coordinates for d2a6hl2:

Click to download the PDB-style file with coordinates for d2a6hl2.
(The format of our PDB-style files is described here.)

Timeline for d2a6hl2: