Lineage for d2a6he_ (2a6h E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2347782Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
    core: 2 helices and adjacent loops
  4. 2347783Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) (S)
    the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits
  5. 2347784Family a.143.1.1: RNA polymerase omega subunit [63563] (2 proteins)
    4 helices; irregular array
  6. 2347785Protein RNA polymerase omega subunit [63564] (3 species)
  7. 2347803Species Thermus thermophilus [TaxId:274] [74729] (11 PDB entries)
    Uniprot Q8RQE7; part of multichain biological unit
  8. 2347806Domain d2a6he_: 2a6h E: [126266]
    Other proteins in same PDB: d2a6ha1, d2a6ha2, d2a6hb1, d2a6hb2, d2a6hc_, d2a6hd_, d2a6hf1, d2a6hf2, d2a6hf3, d2a6hk1, d2a6hk2, d2a6hl1, d2a6hl2, d2a6hm_, d2a6hn_, d2a6hp1, d2a6hp2, d2a6hp3
    automated match to d1iw7e_
    protein/RNA complex; complexed with mg, std, zn

Details for d2a6he_

PDB Entry: 2a6h (more details), 2.4 Å

PDB Description: Crystal structure of the T. thermophilus RNA polymerase holoenzyme in complex with antibiotic sterptolydigin
PDB Compounds: (E:) RNA polymerase omega chain

SCOPe Domain Sequences for d2a6he_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a6he_ a.143.1.1 (E:) RNA polymerase omega subunit {Thermus thermophilus [TaxId: 274]}
aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnae
twamkelltgrlvfgenlvpedrlqkemeriypge

SCOPe Domain Coordinates for d2a6he_:

Click to download the PDB-style file with coordinates for d2a6he_.
(The format of our PDB-style files is described here.)

Timeline for d2a6he_: