SCOP 1.75: Domain d2a6he1: 2a6h E:2-96

Lineage for d2a6he1 (2a6h E:2-96)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
   core: 2 helices and adjacent loops

4. Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families)
   the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits

5. Family a.143.1.1: RNA polymerase omega subunit [63563] (1 protein)
   4 helices; irregular array

6. Protein RNA polymerase omega subunit [63564] (3 species)

7. Species Thermus thermophilus [TaxId:274] [74729] (9 PDB entries)
   Uniprot Q8RQE7; part of multichain biological unit

8. Domain d2a6he1: 2a6h E:2-96 [126266]
   Other proteins in same PDB: d2a6ha1, d2a6ha2, d2a6hb1, d2a6hb2, d2a6hc1, d2a6hd1, d2a6hf1, d2a6hf2, d2a6hf3, d2a6hk1, d2a6hk2, d2a6hl1, d2a6hl2, d2a6hm1, d2a6hn1, d2a6hp1, d2a6hp2, d2a6hp3
   automatically matched to d1iw7e_
   complexed with mg, std, zn

Details for d2a6he1

PDB Entry: 2a6h, 2.4 Å

PDB Description: Crystal structure of the T. thermophilus RNA polymerase holoenzyme in complex with antibiotic sterptolydigin

PDB Compounds: (E:) RNA polymerase omega chain

SCOP Domain Sequences for d2a6he1:

Sequence; same for both SEQRES and ATOM records:

>d2a6he1 a.143.1.1 (E:2-96) RNA polymerase omega subunit {Thermus thermophilus [TaxId: 274]}
aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnae
twamkelltgrlvfgenlvpedrlqkemeriypge

Timeline for d2a6he1:

• d2a6he1 first appeared in SCOP 1.73
  
• d2a6he1 is called d2a6he_ in SCOPe 2.01
  
• d2a6he1 appears in the current release, SCOPe 2.08, called d2a6he_