Lineage for d2a6hb1 (2a6h B:1-49,B:173-229)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2564740Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2564876Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) (S)
    form homo and heterodimers
  5. 2564877Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (3 proteins)
  6. 2564878Protein RNA polymerase alpha [55259] (3 species)
  7. 2564893Species Thermus thermophilus [TaxId:274] [75478] (16 PDB entries)
    Uniprot Q9Z9H6; part of multichain biological unit
  8. 2564907Domain d2a6hb1: 2a6h B:1-49,B:173-229 [126262]
    Other proteins in same PDB: d2a6ha2, d2a6hb2, d2a6hc_, d2a6hd_, d2a6he_, d2a6hf1, d2a6hf2, d2a6hf3, d2a6hk2, d2a6hl2, d2a6hm_, d2a6hn_, d2a6ho_, d2a6hp1, d2a6hp2, d2a6hp3
    automated match to d1smya1
    protein/RNA complex; complexed with mg, std, zn

Details for d2a6hb1

PDB Entry: 2a6h (more details), 2.4 Å

PDB Description: Crystal structure of the T. thermophilus RNA polymerase holoenzyme in complex with antibiotic sterptolydigin
PDB Compounds: (B:) DNA-directed RNA polymerase alpha chain

SCOPe Domain Sequences for d2a6hb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a6hb1 d.74.3.1 (B:1-49,B:173-229) RNA polymerase alpha {Thermus thermophilus [TaxId: 274]}
mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipXpvrrvafqve
dtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpq

SCOPe Domain Coordinates for d2a6hb1:

Click to download the PDB-style file with coordinates for d2a6hb1.
(The format of our PDB-style files is described here.)

Timeline for d2a6hb1: