Lineage for d2a6ha2 (2a6h A:50-172)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 879236Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
    unusual fold; contains a left-handed beta-alpha-beta unit
  4. 879237Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) (S)
  5. 879238Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins)
  6. 879239Protein RNA polymerase alpha subunit [56555] (3 species)
  7. 879254Species Thermus thermophilus [TaxId:274] [75595] (9 PDB entries)
    Uniprot Q9Z9H6; part of multichain biological unit
  8. 879259Domain d2a6ha2: 2a6h A:50-172 [126261]
    Other proteins in same PDB: d2a6ha1, d2a6hb1, d2a6hc1, d2a6hd1, d2a6he1, d2a6hf1, d2a6hf2, d2a6hf3, d2a6hk1, d2a6hl1, d2a6hm1, d2a6hn1, d2a6ho1, d2a6hp1, d2a6hp2, d2a6hp3
    automatically matched to d1iw7a2
    complexed with mg, std, zn

Details for d2a6ha2

PDB Entry: 2a6h (more details), 2.4 Å

PDB Description: Crystal structure of the T. thermophilus RNA polymerase holoenzyme in complex with antibiotic sterptolydigin
PDB Compounds: (A:) DNA-directed RNA polymerase alpha chain

SCOP Domain Sequences for d2a6ha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a6ha2 d.181.1.1 (A:50-172) RNA polymerase alpha subunit {Thermus thermophilus [TaxId: 274]}
gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkev
kardflpvadveimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvda
vfs

SCOP Domain Coordinates for d2a6ha2:

Click to download the PDB-style file with coordinates for d2a6ha2.
(The format of our PDB-style files is described here.)

Timeline for d2a6ha2: