![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily) unusual fold; contains a left-handed beta-alpha-beta unit |
![]() | Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) ![]() automatically mapped to Pfam PF01000 |
![]() | Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (3 proteins) |
![]() | Protein RNA polymerase alpha subunit [56555] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [75595] (16 PDB entries) Uniprot Q9Z9H6; part of multichain biological unit |
![]() | Domain d2a6ha2: 2a6h A:50-172 [126261] Other proteins in same PDB: d2a6ha1, d2a6hb1, d2a6hc_, d2a6hd_, d2a6he_, d2a6hf1, d2a6hf2, d2a6hf3, d2a6hk1, d2a6hl1, d2a6hm_, d2a6hn_, d2a6ho_, d2a6hp1, d2a6hp2, d2a6hp3 automated match to d1smya2 protein/RNA complex; complexed with mg, std, zn |
PDB Entry: 2a6h (more details), 2.4 Å
SCOPe Domain Sequences for d2a6ha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a6ha2 d.181.1.1 (A:50-172) RNA polymerase alpha subunit {Thermus thermophilus [TaxId: 274]} gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkev kardflpvadveimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvda vfs
Timeline for d2a6ha2: