Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily) unusual fold; contains a left-handed beta-alpha-beta unit |
Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) automatically mapped to Pfam PF01000 |
Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (3 proteins) |
Protein RNA polymerase alpha subunit [56555] (3 species) |
Species Thermus thermophilus [TaxId:274] [75595] (16 PDB entries) Uniprot Q9Z9H6; part of multichain biological unit |
Domain d2a6el2: 2a6e L:50-172 [126253] Other proteins in same PDB: d2a6ea1, d2a6eb1, d2a6ec_, d2a6ed_, d2a6ee_, d2a6ef1, d2a6ef2, d2a6ef3, d2a6ek1, d2a6el1, d2a6em_, d2a6en_, d2a6eo_, d2a6ep1, d2a6ep2, d2a6ep3 automated match to d1smya2 complexed with mg, zn |
PDB Entry: 2a6e (more details), 2.8 Å
SCOPe Domain Sequences for d2a6el2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a6el2 d.181.1.1 (L:50-172) RNA polymerase alpha subunit {Thermus thermophilus [TaxId: 274]} gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkev kardflpvadveimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvda vfs
Timeline for d2a6el2: