SCOPe 2.01: Domain d2a6el1: 2a6e L:1-49,L:173-229

Lineage for d2a6el1 (2a6e L:1-49,L:173-229)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.74: DCoH-like [55247] (5 superfamilies)
   beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta

4. Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families)
   form homo and heterodimers

5. Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins)

6. Protein RNA polymerase alpha [55259] (3 species)

7. Species Thermus thermophilus [TaxId:274] [75478] (9 PDB entries)
   Uniprot Q9Z9H6; part of multichain biological unit

8. Domain d2a6el1: 2a6e L:1-49,L:173-229 [126252]
   Other proteins in same PDB: d2a6ea2, d2a6eb2, d2a6ec_, d2a6ed1, d2a6ee_, d2a6ef1, d2a6ef2, d2a6ef3, d2a6ek2, d2a6el2, d2a6em_, d2a6en1, d2a6eo_, d2a6ep1, d2a6ep2, d2a6ep3
   automatically matched to d1iw7a1
   complexed with mg, zn

Details for d2a6el1

PDB Entry: 2a6e, 2.8 Å

PDB Description: Crystal structure of the T. Thermophilus RNA polymerase holoenzyme

PDB Compounds: (L:) DNA-directed RNA polymerase alpha chain

SCOPe Domain Sequences for d2a6el1:

Sequence; same for both SEQRES and ATOM records:

>d2a6el1 d.74.3.1 (L:1-49,L:173-229) RNA polymerase alpha {Thermus thermophilus [TaxId: 274]}
mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipXpvrrvafqve
dtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpq

Timeline for d2a6el1:

• d2a6el1 first appeared in SCOP 1.73
  
• d2a6el1 appears in SCOP 1.75
  
• d2a6el1 appears in SCOPe 2.02
  
• d2a6el1 appears in the current release, SCOPe 2.08