Class a: All alpha proteins [46456] (289 folds) |
Fold a.177: Sigma2 domain of RNA polymerase sigma factors [88945] (1 superfamily) multihelical; consists of a conserved 4-helical core and a variable insert subdomain |
Superfamily a.177.1: Sigma2 domain of RNA polymerase sigma factors [88946] (2 families) |
Family a.177.1.1: Sigma2 domain of RNA polymerase sigma factors [88947] (6 proteins) |
Protein Sigma70 [88948] (2 species) |
Species Thermus thermophilus [TaxId:274] [88949] (11 PDB entries) Uniprot Q9WX78 |
Domain d2a6ef3: 2a6e F:74-257 [126249] Other proteins in same PDB: d2a6ea1, d2a6ea2, d2a6eb1, d2a6eb2, d2a6ec_, d2a6ed_, d2a6ee_, d2a6ef1, d2a6ef2, d2a6ek1, d2a6ek2, d2a6el1, d2a6el2, d2a6em_, d2a6en_, d2a6eo_, d2a6ep1, d2a6ep2 automated match to d1smyf3 complexed with mg, zn |
PDB Entry: 2a6e (more details), 2.8 Å
SCOPe Domain Sequences for d2a6ef3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a6ef3 a.177.1.1 (F:74-257) Sigma70 {Thermus thermophilus [TaxId: 274]} kistsdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvra kilgsarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanlr lvvsiakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiad qart
Timeline for d2a6ef3: