Lineage for d2a6ef2 (2a6e F:319-423)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2309198Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) (S)
  5. 2309233Family a.4.13.2: Sigma4 domain [88665] (5 proteins)
  6. 2309241Protein Sigma70 (SigA, RpoD) [88666] (4 species)
    Pfam PF03979
  7. 2309255Species Thermus thermophilus [TaxId:274] [88667] (11 PDB entries)
    Uniprot Q9WX78
  8. 2309270Domain d2a6ef2: 2a6e F:319-423 [126248]
    Other proteins in same PDB: d2a6ea1, d2a6ea2, d2a6eb1, d2a6eb2, d2a6ec_, d2a6ed_, d2a6ee_, d2a6ef1, d2a6ef3, d2a6ek1, d2a6ek2, d2a6el1, d2a6el2, d2a6em_, d2a6en_, d2a6eo_, d2a6ep1, d2a6ep3
    automated match to d1smyf2
    complexed with mg, zn

Details for d2a6ef2

PDB Entry: 2a6e (more details), 2.8 Å

PDB Description: Crystal structure of the T. Thermophilus RNA polymerase holoenzyme
PDB Compounds: (F:) RNA polymerase sigma factor rpoD

SCOPe Domain Sequences for d2a6ef2:

Sequence, based on SEQRES records: (download)

>d2a6ef2 a.4.13.2 (F:319-423) Sigma70 (SigA, RpoD) {Thermus thermophilus [TaxId: 274]}
tpigdekdsfygdfipdehlpspvdaatqsllseelekalsklsereamvlklrkglidg
rehtleevgaffgvtrerirqienkalrklkyhesrtrklrdfld

Sequence, based on observed residues (ATOM records): (download)

>d2a6ef2 a.4.13.2 (F:319-423) Sigma70 (SigA, RpoD) {Thermus thermophilus [TaxId: 274]}
tpigdekdsfygdfipdehlpspvdaatqsllseelekalsklsereamvlklrkglidg
eevgaffgvtrerirqienkalrklkyhesrtrklrdfld

SCOPe Domain Coordinates for d2a6ef2:

Click to download the PDB-style file with coordinates for d2a6ef2.
(The format of our PDB-style files is described here.)

Timeline for d2a6ef2: