Lineage for d2a6ec_ (2a6e C:)

  1. Root: SCOPe 2.01
  2. 1054197Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1057387Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 1057388Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 1057389Family e.29.1.1: RNA-polymerase beta [64485] (3 proteins)
  6. 1057441Protein automated matches [190192] (3 species)
    not a true protein
  7. 1057445Species Thermus thermophilus [TaxId:274] [186932] (6 PDB entries)
  8. 1057456Domain d2a6ec_: 2a6e C: [126244]
    Other proteins in same PDB: d2a6ea1, d2a6ea2, d2a6eb1, d2a6eb2, d2a6ed1, d2a6ee_, d2a6ef1, d2a6ef2, d2a6ef3, d2a6ek1, d2a6ek2, d2a6el1, d2a6el2, d2a6en1, d2a6eo_, d2a6ep1, d2a6ep2, d2a6ep3
    automated match to d1iw7c_
    complexed with mg, zn

Details for d2a6ec_

PDB Entry: 2a6e (more details), 2.8 Å

PDB Description: Crystal structure of the T. Thermophilus RNA polymerase holoenzyme
PDB Compounds: (C:) DNA-directed RNA polymerase beta chain

SCOPe Domain Sequences for d2a6ec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a6ec_ e.29.1.1 (C:) automated matches {Thermus thermophilus [TaxId: 274]}
meikrfgrireviplpplteiqvesyrralqadvppekrenvgiqaafretfpieeedkg
kgglvldfleyrlgeppfpqdecrekdltyqaplyarlqlihkdtglikedevflghipl
mtedgsfiingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidlevepng
vvsmkvnkrkfplvlllrvlgydqetlarelgaygelvqglmdesvfamrpeealirlft
llrpgdppkrdkavayvygliadprrydlgeagrykaeeklgirlsgrtlarfedgefkd
evflptlrylfaltagvpghevddidhlgnrrirtvgelmtdqfrvglarlargvrerml
mgsedsltpaklvnsrpleaaireffsrsqlsqfkdetnplsslrhkrrisalgpggltr
eragfdvrdvhrthygricpvetpeganiglitslaayarvdelgfirtpyrrvvggvvt
devvymtateedrytiaqantplegnriaaervvarrkgepvivspeevefmdvspkqvf
svntnlipflehddanralmgsnmqtqavpliraqapvvmtgleervvrdslaalyaeed
gevakvdgnrivvryedgrlveyplrrfyrsnqgtaldqrprvvvgqrvrkgdlladgpa
sengflalgqnvlvaimpfdgynfedaiviseellkrdfytsihieryeieardtklgpe
ritrdiphlseaalrdldeegvvrigaevkpgdilvgrtsfkgeseptpeerllrsifge
kardvkdtslrvppgeggivvrtvrlrrgdpgvelkpgvrevvrvyvaqkrklqvgdkla
nrhgnkgvvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyflgqr
yispifdgakepeikellaqafevyfgkrkgegfgvdkrevevlrraeklglvtpgktpe
eqlkelflqgkvvlydgrtgepiegpivvgqmfimklyhmvedkmharstgpyslitqqp
lggkaqfggqrfgemevwaleaygaahtlqemltlksddiegrnaayeaiikgedvpeps
vpesfrvlvkelqalaldvqtldekdnpvdifeglaskr

SCOPe Domain Coordinates for d2a6ec_:

Click to download the PDB-style file with coordinates for d2a6ec_.
(The format of our PDB-style files is described here.)

Timeline for d2a6ec_: