Lineage for d2a6eb2 (2a6e B:50-172)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2610858Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
    unusual fold; contains a left-handed beta-alpha-beta unit
  4. 2610859Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) (S)
    automatically mapped to Pfam PF01000
  5. 2610860Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (3 proteins)
  6. 2610861Protein RNA polymerase alpha subunit [56555] (3 species)
  7. 2610876Species Thermus thermophilus [TaxId:274] [75595] (16 PDB entries)
    Uniprot Q9Z9H6; part of multichain biological unit
  8. 2610918Domain d2a6eb2: 2a6e B:50-172 [126243]
    Other proteins in same PDB: d2a6ea1, d2a6eb1, d2a6ec_, d2a6ed_, d2a6ee_, d2a6ef1, d2a6ef2, d2a6ef3, d2a6ek1, d2a6el1, d2a6em_, d2a6en_, d2a6eo_, d2a6ep1, d2a6ep2, d2a6ep3
    automated match to d1smya2
    complexed with mg, zn

Details for d2a6eb2

PDB Entry: 2a6e (more details), 2.8 Å

PDB Description: Crystal structure of the T. Thermophilus RNA polymerase holoenzyme
PDB Compounds: (B:) DNA-directed RNA polymerase alpha chain

SCOPe Domain Sequences for d2a6eb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a6eb2 d.181.1.1 (B:50-172) RNA polymerase alpha subunit {Thermus thermophilus [TaxId: 274]}
gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkev
kardflpvadveimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvda
vfs

SCOPe Domain Coordinates for d2a6eb2:

Click to download the PDB-style file with coordinates for d2a6eb2.
(The format of our PDB-style files is described here.)

Timeline for d2a6eb2: