Lineage for d2a6ea2 (2a6e A:50-172)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 879236Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
    unusual fold; contains a left-handed beta-alpha-beta unit
  4. 879237Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) (S)
  5. 879238Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins)
  6. 879239Protein RNA polymerase alpha subunit [56555] (3 species)
  7. 879254Species Thermus thermophilus [TaxId:274] [75595] (9 PDB entries)
    Uniprot Q9Z9H6; part of multichain biological unit
  8. 879279Domain d2a6ea2: 2a6e A:50-172 [126241]
    Other proteins in same PDB: d2a6ea1, d2a6eb1, d2a6ec1, d2a6ed1, d2a6ee1, d2a6ef1, d2a6ef2, d2a6ef3, d2a6ek1, d2a6el1, d2a6em1, d2a6en1, d2a6eo1, d2a6ep1, d2a6ep2, d2a6ep3
    automatically matched to d1iw7a2
    complexed with mg, zn

Details for d2a6ea2

PDB Entry: 2a6e (more details), 2.8 Å

PDB Description: Crystal structure of the T. Thermophilus RNA polymerase holoenzyme
PDB Compounds: (A:) DNA-directed RNA polymerase alpha chain

SCOP Domain Sequences for d2a6ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a6ea2 d.181.1.1 (A:50-172) RNA polymerase alpha subunit {Thermus thermophilus [TaxId: 274]}
gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkev
kardflpvadveimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvda
vfs

SCOP Domain Coordinates for d2a6ea2:

Click to download the PDB-style file with coordinates for d2a6ea2.
(The format of our PDB-style files is described here.)

Timeline for d2a6ea2: