Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.74: DCoH-like [55247] (5 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) form homo and heterodimers |
Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (3 proteins) |
Protein RNA polymerase alpha [55259] (3 species) |
Species Thermus thermophilus [TaxId:274] [75478] (16 PDB entries) Uniprot Q9Z9H6; part of multichain biological unit |
Domain d2a6ea1: 2a6e A:1-49,A:173-229 [126240] Other proteins in same PDB: d2a6ea2, d2a6eb2, d2a6ec_, d2a6ed_, d2a6ee_, d2a6ef1, d2a6ef2, d2a6ef3, d2a6ek2, d2a6el2, d2a6em_, d2a6en_, d2a6eo_, d2a6ep1, d2a6ep2, d2a6ep3 automated match to d1smya1 complexed with mg, zn |
PDB Entry: 2a6e (more details), 2.8 Å
SCOPe Domain Sequences for d2a6ea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a6ea1 d.74.3.1 (A:1-49,A:173-229) RNA polymerase alpha {Thermus thermophilus [TaxId: 274]} mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipXpvrrvafqve dtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpq
Timeline for d2a6ea1: