SCOPe 2.07: Domain d2a6ba1: 2a6b A:3-221

Lineage for d2a6ba1 (2a6b A:3-221)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.3: TENA/THI-4 [101458] (9 proteins)
   Pfam PF03070; HO-related family lacking the heme-binding site

6. Protein Putative transcriptional regulator SP0716 (SPr0628) [140954] (1 species)

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [140955] (1 PDB entry)
   Uniprot Q97RS7 3-221

8. Domain d2a6ba1: 2a6b A:3-221 [126235]

Details for d2a6ba1

PDB Entry: 2a6b, 1.7 Å

PDB Description: Crystal structure of a putative transcriptional regulator of the tena family (spr0628) from streptococcus pneumoniae r6 at 1.70 A resolution

PDB Compounds: (A:) hypothetical protein spr0628

SCOPe Domain Sequences for d2a6ba1:

Sequence; same for both SEQRES and ATOM records:

>d2a6ba1 a.132.1.3 (A:3-221) Putative transcriptional regulator SP0716 (SPr0628) {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
tqdyafqpgltvgellkssqkdwqaainhrfvkelfagtienkvlkdyliqdyhffdafl
smlgacvahadklesklrfakqlgfleadedgyfqkafkelkvaendylevtlhpvtkaf
qdlmysavassdyahllvmlviaeglyldwgskdlalpevyihsewinlhrgpffaewvq
flvdelnrvgknredltelqqrwnqavalelaffdigyd

Timeline for d2a6ba1:

• d2a6ba1 first appeared in SCOP 1.73
  
• d2a6ba1 appears in SCOPe 2.06
  
• d2a6ba1 appears in the current release, SCOPe 2.08