Lineage for d2a6ba1 (2a6b A:3-221)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732616Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2732617Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2732777Family a.132.1.3: TENA/THI-4 [101458] (9 proteins)
    Pfam PF03070; HO-related family lacking the heme-binding site
  6. 2732804Protein Putative transcriptional regulator SP0716 (SPr0628) [140954] (1 species)
  7. 2732805Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [140955] (1 PDB entry)
    Uniprot Q97RS7 3-221
  8. 2732806Domain d2a6ba1: 2a6b A:3-221 [126235]

Details for d2a6ba1

PDB Entry: 2a6b (more details), 1.7 Å

PDB Description: Crystal structure of a putative transcriptional regulator of the tena family (spr0628) from streptococcus pneumoniae r6 at 1.70 A resolution
PDB Compounds: (A:) hypothetical protein spr0628

SCOPe Domain Sequences for d2a6ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a6ba1 a.132.1.3 (A:3-221) Putative transcriptional regulator SP0716 (SPr0628) {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
tqdyafqpgltvgellkssqkdwqaainhrfvkelfagtienkvlkdyliqdyhffdafl
smlgacvahadklesklrfakqlgfleadedgyfqkafkelkvaendylevtlhpvtkaf
qdlmysavassdyahllvmlviaeglyldwgskdlalpevyihsewinlhrgpffaewvq
flvdelnrvgknredltelqqrwnqavalelaffdigyd

SCOPe Domain Coordinates for d2a6ba1:

Click to download the PDB-style file with coordinates for d2a6ba1.
(The format of our PDB-style files is described here.)

Timeline for d2a6ba1: