![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.9: YeaZ-like [110633] (3 proteins) Pfam PF00814; ubiquitous cytoplasmic protein; annotated as Glycoprotease (Peptidase_M22 family) on the basis of one member's known extracellular activity |
![]() | Protein Hypothetical protein TM0874 [142467] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [142468] (1 PDB entry) Uniprot Q9WZX7 1-103! Uniprot Q9WZX7 104-193 |
![]() | Domain d2a6ab2: 2a6a B:104-187 [126234] Other proteins in same PDB: d2a6ab3 automated match to d2a6aa2 complexed with unl |
PDB Entry: 2a6a (more details), 2.5 Å
SCOPe Domain Sequences for d2a6ab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a6ab2 c.55.1.9 (B:104-187) Hypothetical protein TM0874 {Thermotoga maritima [TaxId: 2336]} dgvvlvarrarkgyhycavylkdkglnplkepsvvsdeeleeitkefspkivlkddllis pavlveeserlfrekktihyyeie
Timeline for d2a6ab2: