Lineage for d2a69p3 (2a69 P:74-257)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1752715Fold a.177: Sigma2 domain of RNA polymerase sigma factors [88945] (1 superfamily)
    multihelical; consists of a conserved 4-helical core and a variable insert subdomain
  4. 1752716Superfamily a.177.1: Sigma2 domain of RNA polymerase sigma factors [88946] (2 families) (S)
  5. 1752717Family a.177.1.1: Sigma2 domain of RNA polymerase sigma factors [88947] (6 proteins)
  6. 1752733Protein Sigma70 [88948] (2 species)
  7. 1752736Species Thermus thermophilus [TaxId:274] [88949] (9 PDB entries)
    Uniprot Q9WX78
  8. 1752746Domain d2a69p3: 2a69 P:74-257 [126230]
    Other proteins in same PDB: d2a69a1, d2a69a2, d2a69b1, d2a69b2, d2a69c_, d2a69d_, d2a69e_, d2a69f1, d2a69f2, d2a69k1, d2a69k2, d2a69l1, d2a69l2, d2a69m_, d2a69n_, d2a69o_, d2a69p1, d2a69p2
    automated match to d1smyf3
    protein/RNA complex; complexed with mg, rpt, zn

Details for d2a69p3

PDB Entry: 2a69 (more details), 2.5 Å

PDB Description: Crystal structure of the T. Thermophilus RNA polymerase holoenzyme in complex with antibiotic rifapentin
PDB Compounds: (P:) RNA polymerase sigma factor rpoD

SCOPe Domain Sequences for d2a69p3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a69p3 a.177.1.1 (P:74-257) Sigma70 {Thermus thermophilus [TaxId: 274]}
kistsdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvra
kilgsarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanlr
lvvsiakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiad
qart

SCOPe Domain Coordinates for d2a69p3:

Click to download the PDB-style file with coordinates for d2a69p3.
(The format of our PDB-style files is described here.)

Timeline for d2a69p3: