Lineage for d2a69p1 (2a69 P:258-318)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1078587Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1081117Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (3 families) (S)
  5. 1081118Family a.4.13.1: Sigma3 domain [88660] (3 proteins)
  6. 1081130Protein Sigma70 [88661] (1 species)
  7. 1081131Species Thermus thermophilus [TaxId:274] [88662] (9 PDB entries)
    Uniprot Q9WX78
  8. 1081141Domain d2a69p1: 2a69 P:258-318 [126228]
    Other proteins in same PDB: d2a69a1, d2a69a2, d2a69b1, d2a69b2, d2a69c_, d2a69d1, d2a69e_, d2a69f2, d2a69f3, d2a69k1, d2a69k2, d2a69l1, d2a69l2, d2a69m_, d2a69n1, d2a69o_, d2a69p2, d2a69p3
    automatically matched to d1iw7f1
    protein/RNA complex; complexed with mg, rpt, zn

Details for d2a69p1

PDB Entry: 2a69 (more details), 2.5 Å

PDB Description: Crystal structure of the T. Thermophilus RNA polymerase holoenzyme in complex with antibiotic rifapentin
PDB Compounds: (P:) RNA polymerase sigma factor rpoD

SCOPe Domain Sequences for d2a69p1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a69p1 a.4.13.1 (P:258-318) Sigma70 {Thermus thermophilus [TaxId: 274]}
iripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwdakrveetlkiaqepvsl
e

SCOPe Domain Coordinates for d2a69p1:

Click to download the PDB-style file with coordinates for d2a69p1.
(The format of our PDB-style files is described here.)

Timeline for d2a69p1: