Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (3 families) |
Family a.4.13.1: Sigma3 domain [88660] (3 proteins) |
Protein Sigma70 [88661] (1 species) |
Species Thermus thermophilus [TaxId:274] [88662] (9 PDB entries) Uniprot Q9WX78 |
Domain d2a69p1: 2a69 P:258-318 [126228] Other proteins in same PDB: d2a69a1, d2a69a2, d2a69b1, d2a69b2, d2a69c_, d2a69d1, d2a69e_, d2a69f2, d2a69f3, d2a69k1, d2a69k2, d2a69l1, d2a69l2, d2a69m_, d2a69n1, d2a69o_, d2a69p2, d2a69p3 automatically matched to d1iw7f1 protein/RNA complex; complexed with mg, rpt, zn |
PDB Entry: 2a69 (more details), 2.5 Å
SCOPe Domain Sequences for d2a69p1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a69p1 a.4.13.1 (P:258-318) Sigma70 {Thermus thermophilus [TaxId: 274]} iripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwdakrveetlkiaqepvsl e
Timeline for d2a69p1: