Class a: All alpha proteins [46456] (286 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) |
Family a.4.13.2: Sigma4 domain [88665] (5 proteins) |
Protein Sigma70 (SigA, RpoD) [88666] (4 species) |
Species Thermus thermophilus [TaxId:274] [88667] (9 PDB entries) Uniprot Q9WX78 |
Domain d2a69f2: 2a69 F:319-423 [126219] Other proteins in same PDB: d2a69a1, d2a69a2, d2a69b1, d2a69b2, d2a69c_, d2a69d_, d2a69e_, d2a69f1, d2a69f3, d2a69k1, d2a69k2, d2a69l1, d2a69l2, d2a69m_, d2a69n_, d2a69o_, d2a69p1, d2a69p3 automated match to d1smyf2 protein/RNA complex; complexed with mg, rpt, zn |
PDB Entry: 2a69 (more details), 2.5 Å
SCOPe Domain Sequences for d2a69f2:
Sequence, based on SEQRES records: (download)
>d2a69f2 a.4.13.2 (F:319-423) Sigma70 (SigA, RpoD) {Thermus thermophilus [TaxId: 274]} tpigdekdsfygdfipdehlpspvdaatqsllseelekalsklsereamvlklrkglidg rehtleevgaffgvtrerirqienkalrklkyhesrtrklrdfld
>d2a69f2 a.4.13.2 (F:319-423) Sigma70 (SigA, RpoD) {Thermus thermophilus [TaxId: 274]} tpigdekdsfygdfipdehlpspvdaatqsllseelekalsklsereamvlklrkglidg eevgaffgvtrerirqienkalrklkyhesrtrklrdfld
Timeline for d2a69f2: