SCOPe 2.05: Domain d2a69b2: 2a69 B:50-172

Lineage for d2a69b2 (2a69 B:50-172)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
   unusual fold; contains a left-handed beta-alpha-beta unit

4. Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family)
   automatically mapped to Pfam PF01000

5. Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins)

6. Protein RNA polymerase alpha subunit [56555] (3 species)

7. Species Thermus thermophilus [TaxId:274] [75595] (14 PDB entries)
   Uniprot Q9Z9H6; part of multichain biological unit

8. Domain d2a69b2: 2a69 B:50-172 [126214]
   Other proteins in same PDB: d2a69a1, d2a69b1, d2a69c_, d2a69d_, d2a69e_, d2a69f1, d2a69f2, d2a69f3, d2a69k1, d2a69l1, d2a69m_, d2a69n_, d2a69o_, d2a69p1, d2a69p2, d2a69p3
   automated match to d1smya2
   protein/RNA complex; complexed with mg, rpt, zn

Details for d2a69b2

PDB Entry: 2a69, 2.5 Å

PDB Description: Crystal structure of the T. Thermophilus RNA polymerase holoenzyme in complex with antibiotic rifapentin

PDB Compounds: (B:) DNA-directed RNA polymerase alpha chain

SCOPe Domain Sequences for d2a69b2:

Sequence; same for both SEQRES and ATOM records:

>d2a69b2 d.181.1.1 (B:50-172) RNA polymerase alpha subunit {Thermus thermophilus [TaxId: 274]}
gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkev
kardflpvadveimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvda
vfs

Timeline for d2a69b2:

• d2a69b2 first appeared in SCOP 1.73
  
• d2a69b2 appears in SCOPe 2.04
  
• d2a69b2 appears in SCOPe 2.06
  
• d2a69b2 appears in the current release, SCOPe 2.08