SCOPe 2.02: Domain d2a69b1: 2a69 B:1-49,B:173-229

Lineage for d2a69b1 (2a69 B:1-49,B:173-229)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.74: DCoH-like [55247] (5 superfamilies)
   beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta

4. Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families)
   form homo and heterodimers

5. Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins)

6. Protein RNA polymerase alpha [55259] (3 species)

7. Species Thermus thermophilus [TaxId:274] [75478] (9 PDB entries)
   Uniprot Q9Z9H6; part of multichain biological unit

8. Domain d2a69b1: 2a69 B:1-49,B:173-229 [126213]
   Other proteins in same PDB: d2a69a2, d2a69b2, d2a69c_, d2a69d1, d2a69e_, d2a69f1, d2a69f2, d2a69f3, d2a69k2, d2a69l2, d2a69m_, d2a69n1, d2a69o_, d2a69p1, d2a69p2, d2a69p3
   automatically matched to d1iw7a1
   protein/RNA complex; complexed with mg, rpt, zn

Details for d2a69b1

PDB Entry: 2a69, 2.5 Å

PDB Description: Crystal structure of the T. Thermophilus RNA polymerase holoenzyme in complex with antibiotic rifapentin

PDB Compounds: (B:) DNA-directed RNA polymerase alpha chain

SCOPe Domain Sequences for d2a69b1:

Sequence; same for both SEQRES and ATOM records:

>d2a69b1 d.74.3.1 (B:1-49,B:173-229) RNA polymerase alpha {Thermus thermophilus [TaxId: 274]}
mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipXpvrrvafqve
dtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpq

Timeline for d2a69b1:

• d2a69b1 first appeared in SCOP 1.73
  
• d2a69b1 appears in SCOPe 2.01
  
• d2a69b1 appears in SCOPe 2.03
  
• d2a69b1 appears in the current release, SCOPe 2.08