Lineage for d2a69a2 (2a69 A:50-172)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1943125Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
    unusual fold; contains a left-handed beta-alpha-beta unit
  4. 1943126Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) (S)
    automatically mapped to Pfam PF01000
  5. 1943127Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins)
  6. 1943128Protein RNA polymerase alpha subunit [56555] (3 species)
  7. 1943143Species Thermus thermophilus [TaxId:274] [75595] (14 PDB entries)
    Uniprot Q9Z9H6; part of multichain biological unit
  8. 1943172Domain d2a69a2: 2a69 A:50-172 [126212]
    Other proteins in same PDB: d2a69a1, d2a69b1, d2a69c_, d2a69d_, d2a69e_, d2a69f1, d2a69f2, d2a69f3, d2a69k1, d2a69l1, d2a69m_, d2a69n_, d2a69o_, d2a69p1, d2a69p2, d2a69p3
    automated match to d1smya2
    protein/RNA complex; complexed with mg, rpt, zn

Details for d2a69a2

PDB Entry: 2a69 (more details), 2.5 Å

PDB Description: Crystal structure of the T. Thermophilus RNA polymerase holoenzyme in complex with antibiotic rifapentin
PDB Compounds: (A:) DNA-directed RNA polymerase alpha chain

SCOPe Domain Sequences for d2a69a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a69a2 d.181.1.1 (A:50-172) RNA polymerase alpha subunit {Thermus thermophilus [TaxId: 274]}
gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkev
kardflpvadveimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvda
vfs

SCOPe Domain Coordinates for d2a69a2:

Click to download the PDB-style file with coordinates for d2a69a2.
(The format of our PDB-style files is described here.)

Timeline for d2a69a2: