Lineage for d2a68p1 (2a68 P:258-318)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1723765Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) (S)
  5. 1723766Family a.4.13.1: Sigma3 domain [88660] (3 proteins)
  6. 1723778Protein Sigma70 [88661] (1 species)
  7. 1723779Species Thermus thermophilus [TaxId:274] [88662] (9 PDB entries)
    Uniprot Q9WX78
  8. 1723787Domain d2a68p1: 2a68 P:258-318 [126208]
    Other proteins in same PDB: d2a68a1, d2a68a2, d2a68b1, d2a68b2, d2a68c_, d2a68d_, d2a68e_, d2a68f2, d2a68f3, d2a68k1, d2a68k2, d2a68l1, d2a68l2, d2a68m_, d2a68n_, d2a68o_, d2a68p2, d2a68p3
    automated match to d1smyf1
    protein/RNA complex; complexed with mg, rbt, zn

Details for d2a68p1

PDB Entry: 2a68 (more details), 2.5 Å

PDB Description: Crystal structure of the T. thermophilus RNA polymerase holoenzyme in complex with antibiotic rifabutin
PDB Compounds: (P:) RNA polymerase sigma factor rpoD

SCOPe Domain Sequences for d2a68p1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a68p1 a.4.13.1 (P:258-318) Sigma70 {Thermus thermophilus [TaxId: 274]}
iripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwdakrveetlkiaqepvsl
e

SCOPe Domain Coordinates for d2a68p1:

Click to download the PDB-style file with coordinates for d2a68p1.
(The format of our PDB-style files is described here.)

Timeline for d2a68p1: