Class a: All alpha proteins [46456] (286 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) |
Family a.4.13.1: Sigma3 domain [88660] (3 proteins) |
Protein Sigma70 [88661] (1 species) |
Species Thermus thermophilus [TaxId:274] [88662] (9 PDB entries) Uniprot Q9WX78 |
Domain d2a68p1: 2a68 P:258-318 [126208] Other proteins in same PDB: d2a68a1, d2a68a2, d2a68b1, d2a68b2, d2a68c_, d2a68d_, d2a68e_, d2a68f2, d2a68f3, d2a68k1, d2a68k2, d2a68l1, d2a68l2, d2a68m_, d2a68n_, d2a68o_, d2a68p2, d2a68p3 automated match to d1smyf1 protein/RNA complex; complexed with mg, rbt, zn |
PDB Entry: 2a68 (more details), 2.5 Å
SCOPe Domain Sequences for d2a68p1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a68p1 a.4.13.1 (P:258-318) Sigma70 {Thermus thermophilus [TaxId: 274]} iripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwdakrveetlkiaqepvsl e
Timeline for d2a68p1: