| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.74: DCoH-like [55247] (5 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) ![]() form homo and heterodimers |
| Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins) |
| Protein RNA polymerase alpha [55259] (3 species) |
| Species Thermus thermophilus [TaxId:274] [75478] (14 PDB entries) Uniprot Q9Z9H6; part of multichain biological unit |
| Domain d2a68l1: 2a68 L:1-49,L:173-229 [126203] Other proteins in same PDB: d2a68a2, d2a68b2, d2a68c_, d2a68d_, d2a68e_, d2a68f1, d2a68f2, d2a68f3, d2a68k2, d2a68l2, d2a68m_, d2a68n_, d2a68o_, d2a68p1, d2a68p2, d2a68p3 automated match to d1smya1 protein/RNA complex; complexed with mg, rbt, zn |
PDB Entry: 2a68 (more details), 2.5 Å
SCOPe Domain Sequences for d2a68l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a68l1 d.74.3.1 (L:1-49,L:173-229) RNA polymerase alpha {Thermus thermophilus [TaxId: 274]}
mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipXpvrrvafqve
dtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpq
Timeline for d2a68l1: