SCOP 1.73: Domain d2a68k1: 2a68 K:1-49,K:173-229

Lineage for d2a68k1 (2a68 K:1-49,K:173-229)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.74: DCoH-like [55247] (4 superfamilies)
   beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta

4. Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families)
   form homo and heterodimers

5. Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins)

6. Protein RNA polymerase alpha [55259] (3 species)

7. Species Thermus thermophilus [TaxId:274] [75478] (9 PDB entries)

8. Domain d2a68k1: 2a68 K:1-49,K:173-229 [126201]
   Other proteins in same PDB: d2a68a2, d2a68b2, d2a68c1, d2a68d1, d2a68e1, d2a68f1, d2a68f2, d2a68f3, d2a68k2, d2a68l2, d2a68m1, d2a68n1, d2a68o1, d2a68p1, d2a68p2, d2a68p3
   automatically matched to d1iw7a1
   complexed with mg, rbt, zn

Details for d2a68k1

PDB Entry: 2a68, 2.5 Å

PDB Description: Crystal structure of the T. thermophilus RNA polymerase holoenzyme in complex with antibiotic rifabutin

PDB Compounds: (K:) DNA-directed RNA polymerase alpha chain

SCOP Domain Sequences for d2a68k1:

Sequence; same for both SEQRES and ATOM records:

>d2a68k1 d.74.3.1 (K:1-49,K:173-229) RNA polymerase alpha {Thermus thermophilus [TaxId: 274]}
mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipXpvrrvafqve
dtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpq

Timeline for d2a68k1:

• d2a68k1 is new in SCOP 1.73
  
• d2a68k1 appears in SCOP 1.75
  
• d2a68k1 appears in the current release, SCOPe 2.08