Lineage for d2a5zc1 (2a5z C:24-262)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 794080Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 794081Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 795355Family b.29.1.24: SO2946-like [141167] (1 protein)
  6. 795356Protein Hypothetical protein SO2946 [141168] (1 species)
  7. 795357Species Shewanella oneidensis [TaxId:70863] [141169] (1 PDB entry)
    Uniprot Q8ED25 24-262
  8. 795360Domain d2a5zc1: 2a5z C:24-262 [126186]
    automatically matched to 2A5Z A:24-262
    complexed with mg

Details for d2a5zc1

PDB Entry: 2a5z (more details), 2.02 Å

PDB Description: crystal structure of protein of unknown function so2946 from shewanella oneidensis mr-1
PDB Compounds: (C:) hypothetical protein SO2946

SCOP Domain Sequences for d2a5zc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a5zc1 b.29.1.24 (C:24-262) Hypothetical protein SO2946 {Shewanella oneidensis [TaxId: 70863]}
ttpglmspseklklstlttsiatsdfyasydfmmhsigltsannisllstgnislqnils
egnhfgvqpivssttanasflagmlmaifpkeselevtvyfktpsafnpaqltvigstsi
glgisdrsgliiengnafggivkasaatetgstyalststwyickfkmltddrfkvtlys
dsgtqlysytstaamfradnatahigfktqcktatagislisidliefkakvsatrakv

SCOP Domain Coordinates for d2a5zc1:

Click to download the PDB-style file with coordinates for d2a5zc1.
(The format of our PDB-style files is described here.)

Timeline for d2a5zc1: