Lineage for d2a5zc_ (2a5z C:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. Family b.29.1.24: SO2946-like [141167] (1 protein)
  6. Protein Hypothetical protein SO2946 [141168] (1 species)
  7. Species Shewanella oneidensis [TaxId:70863] [141169] (1 PDB entry)
    Uniprot Q8ED25 24-262
  8. Domain d2a5zc_: 2a5z C: [126186]
    automated match to d2a5za1
    complexed with mg

Details for d2a5zc_

PDB Entry: 2a5z (more details), 2.02 Å

PDB Description: crystal structure of protein of unknown function so2946 from shewanella oneidensis mr-1
PDB Compounds: (C:) hypothetical protein SO2946

SCOPe Domain Sequences for d2a5zc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a5zc_ b.29.1.24 (C:) Hypothetical protein SO2946 {Shewanella oneidensis [TaxId: 70863]}
platettpglmspseklklstlttsiatsdfyasydfmmhsigltsannisllstgnisl
qnilsegnhfgvqpivssttanasflagmlmaifpkeselevtvyfktpsafnpaqltvi
gstsiglgisdrsgliiengnafggivkasaatetgstyalststwyickfkmltddrfk
vtlysdsgtqlysytstaamfradnatahigfktqcktatagislisidliefkakvsat
rakv

SCOPe Domain Coordinates for d2a5zc_ are not available.

Timeline for d2a5zc_:

Domains from other chains:
(mouse over for more information)
d2a5za1, d2a5zb_