Lineage for d2a5za1 (2a5z A:24-262)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780592Family b.29.1.24: SO2946-like [141167] (1 protein)
  6. 2780593Protein Hypothetical protein SO2946 [141168] (1 species)
  7. 2780594Species Shewanella oneidensis [TaxId:70863] [141169] (1 PDB entry)
    Uniprot Q8ED25 24-262
  8. 2780595Domain d2a5za1: 2a5z A:24-262 [126184]
    complexed with mg

Details for d2a5za1

PDB Entry: 2a5z (more details), 2.02 Å

PDB Description: crystal structure of protein of unknown function so2946 from shewanella oneidensis mr-1
PDB Compounds: (A:) hypothetical protein SO2946

SCOPe Domain Sequences for d2a5za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a5za1 b.29.1.24 (A:24-262) Hypothetical protein SO2946 {Shewanella oneidensis [TaxId: 70863]}
ttpglmspseklklstlttsiatsdfyasydfmmhsigltsannisllstgnislqnils
egnhfgvqpivssttanasflagmlmaifpkeselevtvyfktpsafnpaqltvigstsi
glgisdrsgliiengnafggivkasaatetgstyalststwyickfkmltddrfkvtlys
dsgtqlysytstaamfradnatahigfktqcktatagislisidliefkakvsatrakv

SCOPe Domain Coordinates for d2a5za1:

Click to download the PDB-style file with coordinates for d2a5za1.
(The format of our PDB-style files is described here.)

Timeline for d2a5za1: