Lineage for d2a5lb_ (2a5l B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2115525Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2115993Family c.23.5.8: WrbA-like [117474] (3 proteins)
  6. 2116037Protein automated matches [190460] (2 species)
    not a true protein
  7. 2116043Species Pseudomonas aeruginosa [TaxId:287] [187375] (1 PDB entry)
  8. 2116044Domain d2a5lb_: 2a5l B: [126177]
    Other proteins in same PDB: d2a5la1
    automated match to d2a5la1
    complexed with mg

Details for d2a5lb_

PDB Entry: 2a5l (more details), 1.7 Å

PDB Description: The crystal structure of the Trp repressor binding protein WrbA from Pseudomonas aeruginosa
PDB Compounds: (B:) Trp repressor binding protein WrbA

SCOPe Domain Sequences for d2a5lb_:

Sequence, based on SEQRES records: (download)

>d2a5lb_ c.23.5.8 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
spyilvlyysrhgataemarqiargveqggfearvrtvpavsteceavapdipaegalya
tledlkncaglalgsptrfgnmasplkyfldgtsslwltgslvgkpaavftstaslhggq
ettqlsmllpllhhgmlvlgipysepalletrgggtpygashfagadgkrsldeheltlc
ralgkrlaetagklgs

Sequence, based on observed residues (ATOM records): (download)

>d2a5lb_ c.23.5.8 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
spyilvlyysrhgataemarqiargveqggfearvrtvpavstealyatledlkncagla
lgsptrfgnmasplkyfldgtsslwltgslvgkpaavftstaslhggqettqlsmllpll
hhgmlvlgipyseptpygashfagadgkrsldeheltlcralgkrlaetagklgs

SCOPe Domain Coordinates for d2a5lb_:

Click to download the PDB-style file with coordinates for d2a5lb_.
(The format of our PDB-style files is described here.)

Timeline for d2a5lb_: