Lineage for d2a5lb1 (2a5l B:3-198)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691580Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 691939Superfamily c.23.5: Flavoproteins [52218] (8 families) (S)
  5. 692182Family c.23.5.8: WrbA-like [117474] (2 proteins)
  6. 692191Protein Trp repressor binding protein WrbA [117475] (2 species)
  7. 692209Species Pseudomonas aeruginosa [TaxId:287] [142053] (3 PDB entries)
  8. 692211Domain d2a5lb1: 2a5l B:3-198 [126177]
    automatically matched to 2A5L A:3-198
    complexed with mg

Details for d2a5lb1

PDB Entry: 2a5l (more details), 1.7 Å

PDB Description: The crystal structure of the Trp repressor binding protein WrbA from Pseudomonas aeruginosa
PDB Compounds: (B:) Trp repressor binding protein WrbA

SCOP Domain Sequences for d2a5lb1:

Sequence, based on SEQRES records: (download)

>d2a5lb1 c.23.5.8 (B:3-198) Trp repressor binding protein WrbA {Pseudomonas aeruginosa [TaxId: 287]}
spyilvlyysrhgataemarqiargveqggfearvrtvpavsteceavapdipaegalya
tledlkncaglalgsptrfgnmasplkyfldgtsslwltgslvgkpaavftstaslhggq
ettqlsmllpllhhgmlvlgipysepalletrgggtpygashfagadgkrsldeheltlc
ralgkrlaetagklgs

Sequence, based on observed residues (ATOM records): (download)

>d2a5lb1 c.23.5.8 (B:3-198) Trp repressor binding protein WrbA {Pseudomonas aeruginosa [TaxId: 287]}
spyilvlyysrhgataemarqiargveqggfearvrtvpavstealyatledlkncagla
lgsptrfgnmasplkyfldgtsslwltgslvgkpaavftstaslhggqettqlsmllpll
hhgmlvlgipyseptpygashfagadgkrsldeheltlcralgkrlaetagklgs

SCOP Domain Coordinates for d2a5lb1:

Click to download the PDB-style file with coordinates for d2a5lb1.
(The format of our PDB-style files is described here.)

Timeline for d2a5lb1: