![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.5: Flavoproteins [52218] (8 families) ![]() |
![]() | Family c.23.5.8: WrbA-like [117474] (2 proteins) |
![]() | Protein Trp repressor binding protein WrbA [117475] (2 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [142053] (3 PDB entries) |
![]() | Domain d2a5lb1: 2a5l B:3-198 [126177] automatically matched to 2A5L A:3-198 complexed with mg |
PDB Entry: 2a5l (more details), 1.7 Å
SCOP Domain Sequences for d2a5lb1:
Sequence, based on SEQRES records: (download)
>d2a5lb1 c.23.5.8 (B:3-198) Trp repressor binding protein WrbA {Pseudomonas aeruginosa [TaxId: 287]} spyilvlyysrhgataemarqiargveqggfearvrtvpavsteceavapdipaegalya tledlkncaglalgsptrfgnmasplkyfldgtsslwltgslvgkpaavftstaslhggq ettqlsmllpllhhgmlvlgipysepalletrgggtpygashfagadgkrsldeheltlc ralgkrlaetagklgs
>d2a5lb1 c.23.5.8 (B:3-198) Trp repressor binding protein WrbA {Pseudomonas aeruginosa [TaxId: 287]} spyilvlyysrhgataemarqiargveqggfearvrtvpavstealyatledlkncagla lgsptrfgnmasplkyfldgtsslwltgslvgkpaavftstaslhggqettqlsmllpll hhgmlvlgipyseptpygashfagadgkrsldeheltlcralgkrlaetagklgs
Timeline for d2a5lb1: