SCOPe 2.08: Domain d2a5lb_: 2a5l B:

Lineage for d2a5lb_ (2a5l B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.8: WrbA-like [117474] (3 proteins)

6. Protein automated matches [190460] (2 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [187375] (1 PDB entry)

8. Domain d2a5lb_: 2a5l B: [126177]
   Other proteins in same PDB: d2a5la1
   automated match to d2a5la1
   complexed with mg

Details for d2a5lb_

PDB Entry: 2a5l, 1.7 Å

PDB Description: The crystal structure of the Trp repressor binding protein WrbA from Pseudomonas aeruginosa

PDB Compounds: (B:) Trp repressor binding protein WrbA

SCOPe Domain Sequences for d2a5lb_:

Sequence, based on SEQRES records:

>d2a5lb_ c.23.5.8 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
spyilvlyysrhgataemarqiargveqggfearvrtvpavsteceavapdipaegalya
tledlkncaglalgsptrfgnmasplkyfldgtsslwltgslvgkpaavftstaslhggq
ettqlsmllpllhhgmlvlgipysepalletrgggtpygashfagadgkrsldeheltlc
ralgkrlaetagklgs

Sequence, based on observed residues (ATOM records):

>d2a5lb_ c.23.5.8 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
spyilvlyysrhgataemarqiargveqggfearvrtvpavstealyatledlkncagla
lgsptrfgnmasplkyfldgtsslwltgslvgkpaavftstaslhggqettqlsmllpll
hhgmlvlgipyseptpygashfagadgkrsldeheltlcralgkrlaetagklgs

Timeline for d2a5lb_:

• d2a5lb_ first appeared in SCOP 1.73, called d2a5lb1
  
• d2a5lb_ appears in SCOPe 2.07