SCOPe 2.07: Domain d2a5la1: 2a5l A:3-198

Lineage for d2a5la1 (2a5l A:3-198)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.8: WrbA-like [117474] (3 proteins)

6. Protein Trp repressor binding protein WrbA [117475] (4 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [142053] (3 PDB entries)
   Uniprot Q9I509 3-198! Uniprot Q9I509 4-196

8. Domain d2a5la1: 2a5l A:3-198 [126176]
   Other proteins in same PDB: d2a5lb_
   complexed with mg

Details for d2a5la1

PDB Entry: 2a5l, 1.7 Å

PDB Description: The crystal structure of the Trp repressor binding protein WrbA from Pseudomonas aeruginosa

PDB Compounds: (A:) Trp repressor binding protein WrbA

SCOPe Domain Sequences for d2a5la1:

Sequence, based on SEQRES records:

>d2a5la1 c.23.5.8 (A:3-198) Trp repressor binding protein WrbA {Pseudomonas aeruginosa [TaxId: 287]}
spyilvlyysrhgataemarqiargveqggfearvrtvpavsteceavapdipaegalya
tledlkncaglalgsptrfgnmasplkyfldgtsslwltgslvgkpaavftstaslhggq
ettqlsmllpllhhgmlvlgipysepalletrgggtpygashfagadgkrsldeheltlc
ralgkrlaetagklgs

Sequence, based on observed residues (ATOM records):

>d2a5la1 c.23.5.8 (A:3-198) Trp repressor binding protein WrbA {Pseudomonas aeruginosa [TaxId: 287]}
spyilvlyysrhgataemarqiargveqggfearvrtvpavstalyatledlkncaglal
gsptrfgnmasplkyfldgtsslwltgslvgkpaavftstaslhggqettqlsmllpllh
hgmlvlgipytpygashfagadgkrsldeheltlcralgkrlaetagklgs

Timeline for d2a5la1:

• d2a5la1 first appeared in SCOP 1.73
  
• d2a5la1 appears in SCOPe 2.06
  
• d2a5la1 appears in the current release, SCOPe 2.08