Lineage for d2a5ja1 (2a5j A:9-181)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845934Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1846528Protein Rab2b [142287] (1 species)
  7. 1846529Species Human (Homo sapiens) [TaxId:9606] [142288] (1 PDB entry)
    Uniprot Q8WUD1 4-176
  8. 1846530Domain d2a5ja1: 2a5j A:9-181 [126175]
    complexed with gdp, mg

Details for d2a5ja1

PDB Entry: 2a5j (more details), 1.5 Å

PDB Description: crystal structure of human rab2b
PDB Compounds: (A:) Ras-related protein Rab-2B

SCOPe Domain Sequences for d2a5ja1:

Sequence, based on SEQRES records: (download)

>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]}
sylfkyiiigdtgvgksclllqftdkrfqpvhdltigvefgarmvnidgkqiklqiwdta
gqesfrsitrsyyrgaagallvyditrretfnhltswledarqhsssnmvimlignksdl
esrrdvkreegeafarehglifmetsaktacnveeafintakeiyrkiqqglf

Sequence, based on observed residues (ATOM records): (download)

>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]}
sylfkyiiigdtgvgksclllqftdkrfqpigvefgarmvnidgkqiklqiwdtagqesf
rsitrsyyrgaagallvyditrretfnhltswledarqhsssnmvimlignksdlesrrd
vkreegeafarehglifmetsaktacnveeafintakeiyrkiqqglf

SCOPe Domain Coordinates for d2a5ja1:

Click to download the PDB-style file with coordinates for d2a5ja1.
(The format of our PDB-style files is described here.)

Timeline for d2a5ja1: