![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein ADP-ribosylation factor [52614] (17 species) |
![]() | Species Human (Homo sapiens), ARF6 [TaxId:9606] [52617] (5 PDB entries) |
![]() | Domain d2a5ga1: 2a5g A:12-173 [126174] Other proteins in same PDB: d2a5gb_ complexed with gtp, mg, na |
PDB Entry: 2a5g (more details), 2.66 Å
SCOPe Domain Sequences for d2a5ga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a5ga1 c.37.1.8 (A:12-173) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} kemrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfnvwdvggldkir plwrhyytgtqglifvvdcadrdridearqelhriindremrdaiilifankqdlpdamk pheiqeklgltrirdrnwyvqpscatsgdglyegltwltsny
Timeline for d2a5ga1: