SCOPe 2.07: Domain d2a5fa_: 2a5f A:

Lineage for d2a5fa_ (2a5f A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (80 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein ADP-ribosylation factor [52614] (16 species)

7. Species Human (Homo sapiens), ARF6 [TaxId:9606] [52617] (5 PDB entries)

8. Domain d2a5fa_: 2a5f A: [126173]
   Other proteins in same PDB: d2a5fb_
   automated match to d1e0sa_
   complexed with gol, gtp, mg, na, nad

Details for d2a5fa_

PDB Entry: 2a5f, 2.02 Å

PDB Description: cholera toxin a1 subunit bound to its substrate, nad+, and its human protein activator, arf6

PDB Compounds: (A:) ADP-ribosylation factor 6

SCOPe Domain Sequences for d2a5fa_:

Sequence; same for both SEQRES and ATOM records:

>d2a5fa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]}
kemrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfnvwdvggqdkir
plwrhyytgtqglifvvdcadrdridearqelhriindremrdaiilifankqdlpdamk
pheiqeklgltrirdrnwyvqpscatsgdglyegltwltsny

Timeline for d2a5fa_:

• d2a5fa_ first appeared in SCOP 1.73, called d2a5fa1
  
• d2a5fa_ appears in SCOPe 2.06
  
• d2a5fa_ appears in the current release, SCOPe 2.08