Lineage for d2a5fa1 (2a5f A:12-173)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 695634Family c.37.1.8: G proteins [52592] (78 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 695635Protein ADP-ribosylation factor [52614] (14 species)
  7. 695664Species Human (Homo sapiens), ARF6 [TaxId:9606] [52617] (5 PDB entries)
  8. 695667Domain d2a5fa1: 2a5f A:12-173 [126173]
    automatically matched to d1e0sa_
    complexed with gol, gtp, mg, na, nad; mutant

Details for d2a5fa1

PDB Entry: 2a5f (more details), 2.02 Å

PDB Description: cholera toxin a1 subunit bound to its substrate, nad+, and its human protein activator, arf6
PDB Compounds: (A:) ADP-ribosylation factor 6

SCOP Domain Sequences for d2a5fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a5fa1 c.37.1.8 (A:12-173) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]}
kemrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfnvwdvggqdkir
plwrhyytgtqglifvvdcadrdridearqelhriindremrdaiilifankqdlpdamk
pheiqeklgltrirdrnwyvqpscatsgdglyegltwltsny

SCOP Domain Coordinates for d2a5fa1:

Click to download the PDB-style file with coordinates for d2a5fa1.
(The format of our PDB-style files is described here.)

Timeline for d2a5fa1: