Lineage for d2a5da_ (2a5d A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2866676Protein ADP-ribosylation factor [52614] (17 species)
  7. 2866714Species Human (Homo sapiens), ARF6 [TaxId:9606] [52617] (5 PDB entries)
  8. 2866715Domain d2a5da_: 2a5d A: [126172]
    Other proteins in same PDB: d2a5db1
    automated match to d1e0sa_
    complexed with gol, gtp, mg, na

Details for d2a5da_

PDB Entry: 2a5d (more details), 1.8 Å

PDB Description: structural basis for the activation of cholera toxin by human arf6-gtp
PDB Compounds: (A:) ADP-ribosylation factor 6

SCOPe Domain Sequences for d2a5da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a5da_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]}
kemrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfnvwdvggqdkir
plwrhyytgtqglifvvdcadrdridearqelhriindremrdaiilifankqdlpdamk
pheiqeklgltrirdrnwyvqpscatsgdglyegltwltsnyk

SCOPe Domain Coordinates for d2a5da_:

Click to download the PDB-style file with coordinates for d2a5da_.
(The format of our PDB-style files is described here.)

Timeline for d2a5da_: