| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein ADP-ribosylation factor [52614] (17 species) |
| Species Human (Homo sapiens), ARF6 [TaxId:9606] [52617] (5 PDB entries) |
| Domain d2a5da_: 2a5d A: [126172] Other proteins in same PDB: d2a5db1 automated match to d1e0sa_ complexed with gol, gtp, mg, na |
PDB Entry: 2a5d (more details), 1.8 Å
SCOPe Domain Sequences for d2a5da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a5da_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]}
kemrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfnvwdvggqdkir
plwrhyytgtqglifvvdcadrdridearqelhriindremrdaiilifankqdlpdamk
pheiqeklgltrirdrnwyvqpscatsgdglyegltwltsnyk
Timeline for d2a5da_: