Lineage for d2a5cb_ (2a5c B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1325092Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 1325093Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 1325094Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 1325401Protein automated matches [190191] (2 species)
    not a true protein
  7. 1325402Species Chicken (Gallus gallus) [TaxId:9031] [186931] (22 PDB entries)
  8. 1325461Domain d2a5cb_: 2a5c B: [126171]
    automated match to d1ij8b_
    protein/DNA complex; complexed with 8da, nag

Details for d2a5cb_

PDB Entry: 2a5c (more details), 2.5 Å

PDB Description: structure of avidin in complex with the ligand 8-oxodeoxyadenosine
PDB Compounds: (B:) Avidin

SCOPe Domain Sequences for d2a5cb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a5cb_ b.61.1.1 (B:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
arkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrt
qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
trl

SCOPe Domain Coordinates for d2a5cb_:

Click to download the PDB-style file with coordinates for d2a5cb_.
(The format of our PDB-style files is described here.)

Timeline for d2a5cb_: