Lineage for d2a5bb1 (2a5b B:3-123)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 674116Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 674117Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) (S)
  5. 674118Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)
  6. 674119Protein Avidin [50880] (1 species)
  7. 674120Species Chicken (Gallus gallus) [TaxId:9031] [50881] (13 PDB entries)
  8. 674136Domain d2a5bb1: 2a5b B:3-123 [126169]
    automatically matched to d1avdb_
    complexed with 8hg, nag

Details for d2a5bb1

PDB Entry: 2a5b (more details), 2.49 Å

PDB Description: avidin complexed with 8-oxodeoxyguanosine
PDB Compounds: (B:) Avidin

SCOP Domain Sequences for d2a5bb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a5bb1 b.61.1.1 (B:3-123) Avidin {Chicken (Gallus gallus) [TaxId: 9031]}
kcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtqp
tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
l

SCOP Domain Coordinates for d2a5bb1:

Click to download the PDB-style file with coordinates for d2a5bb1.
(The format of our PDB-style files is described here.)

Timeline for d2a5bb1: