SCOP 1.73: Domain d2a5ba1: 2a5b A:3-123

Lineage for d2a5ba1 (2a5b A:3-123)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (1 family)

5. Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)

6. Protein Avidin [50880] (1 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [50881] (13 PDB entries)

8. Domain d2a5ba1: 2a5b A:3-123 [126168]
   automatically matched to d1avdb_
   complexed with 8hg, nag

Details for d2a5ba1

PDB Entry: 2a5b, 2.49 Å

PDB Description: Avidin complexed with 8-oxodeoxyguanosine

PDB Compounds: (A:) Avidin

SCOP Domain Sequences for d2a5ba1:

Sequence; same for both SEQRES and ATOM records:

>d2a5ba1 b.61.1.1 (A:3-123) Avidin {Chicken (Gallus gallus) [TaxId: 9031]}
kcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtqp
tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
l

Timeline for d2a5ba1:

• d2a5ba1 is new in SCOP 1.73
  
• d2a5ba1 appears in SCOP 1.75
  
• d2a5ba1 appears in the current release, SCOPe 2.07, called d2a5ba_