Lineage for d2a5ba_ (2a5b A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. Protein automated matches [190191] (2 species)
    not a true protein
  7. Species Chicken (Gallus gallus) [TaxId:9031] [186931] (28 PDB entries)
  8. Domain d2a5ba_: 2a5b A: [126168]
    automated match to d1avdb_
    protein/DNA complex; complexed with 8hg, nag

Details for d2a5ba_

PDB Entry: 2a5b (more details), 2.4899999999999998 Å

PDB Description: avidin complexed with 8-oxodeoxyguanosine
PDB Compounds: (A:) Avidin

SCOPe Domain Sequences for d2a5ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a5ba_ b.61.1.1 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
arkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrt
qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
trlr

SCOPe Domain Coordinates for d2a5ba_ are not available.

Timeline for d2a5ba_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2a5bb_