| Class b: All beta proteins [48724] (180 folds) |
| Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) ![]() |
| Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins) |
| Protein automated matches [190191] (2 species) not a true protein |
| Species Chicken (Gallus gallus) [TaxId:9031] [186931] (28 PDB entries) |
| Domain d2a5ba_: 2a5b A: [126168] automated match to d1avdb_ protein/DNA complex; complexed with 8hg, nag |
PDB Entry: 2a5b (more details), 2.49 Å
SCOPe Domain Sequences for d2a5ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a5ba_ b.61.1.1 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
arkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrt
qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
trlr
Timeline for d2a5ba_: