Lineage for d2a4xb_ (2a4x B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2186669Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2186670Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2186724Family d.32.1.2: Antibiotic resistance proteins [54598] (8 proteins)
    duplication: consists of two clear structural repeats each having this fold
    subunit fold and dimeric assembly are similar to those of glyoxalase
  6. 2186789Protein automated matches [190190] (5 species)
    not a true protein
  7. 2186822Species Streptomyces caespitosus [TaxId:53502] [186930] (2 PDB entries)
  8. 2186824Domain d2a4xb_: 2a4x B: [126167]
    Other proteins in same PDB: d2a4xa3
    automated match to d1kmza_
    complexed with blm

Details for d2a4xb_

PDB Entry: 2a4x (more details), 1.4 Å

PDB Description: Crystal Structure Of Mitomycin C-Binding Protein Complexed with Metal-Free Bleomycin A2
PDB Compounds: (B:) mitomycin-binding protein

SCOPe Domain Sequences for d2a4xb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a4xb_ d.32.1.2 (B:) automated matches {Streptomyces caespitosus [TaxId: 53502]}
sarislfavvvedmakslefyrklgveipaeadsaphteavldggirlawdtvetvrsyd
pewqaptgghrfaiafefpdtasvdkkyaelvdagyeghlkpwnavwgqryaivkdpdgn
vvdlfapl

SCOPe Domain Coordinates for d2a4xb_:

Click to download the PDB-style file with coordinates for d2a4xb_.
(The format of our PDB-style files is described here.)

Timeline for d2a4xb_: