SCOP 1.75: Domain d2a4xb1: 2a4x B:203-329

Lineage for d2a4xb1 (2a4x B:203-329)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (10 families)

5. Family d.32.1.2: Antibiotic resistance proteins [54598] (7 proteins)
   duplication: consists of two clear structural repeats each having this fold
   subunit fold and dimeric assembly are similar to those of glyoxalase

6. Protein Mitomycin resistance protein D, MRD [75394] (1 species)

7. Species Streptomyces lavendulae [TaxId:1914] [75395] (4 PDB entries)

8. Domain d2a4xb1: 2a4x B:203-329 [126167]
   automatically matched to d1kmza_
   complexed with blm

Details for d2a4xb1

PDB Entry: 2a4x, 1.4 Å

PDB Description: Crystal Structure Of Mitomycin C-Binding Protein Complexed with Metal-Free Bleomycin A2

PDB Compounds: (B:) mitomycin-binding protein

SCOP Domain Sequences for d2a4xb1:

Sequence; same for both SEQRES and ATOM records:

>d2a4xb1 d.32.1.2 (B:203-329) Mitomycin resistance protein D, MRD {Streptomyces lavendulae [TaxId: 1914]}
arislfavvvedmakslefyrklgveipaeadsaphteavldggirlawdtvetvrsydp
ewqaptgghrfaiafefpdtasvdkkyaelvdagyeghlkpwnavwgqryaivkdpdgnv
vdlfapl

Timeline for d2a4xb1:

• d2a4xb1 first appeared in SCOP 1.73
  
• d2a4xb1 is called d2a4xb_ in SCOPe 2.01
  
• d2a4xb1 appears in the current release, SCOPe 2.08, called d2a4xb_