Lineage for d2a4xa1 (2a4x A:3-129)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 720941Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 720942Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (10 families) (S)
  5. 720978Family d.32.1.2: Antibiotic resistance proteins [54598] (6 proteins)
    duplication: consists of two clear structural repeats each having this fold
    subunit fold and dimeric assembly are similar to those of glyoxalase
  6. 721036Protein Mitomycin resistance protein D, MRD [75394] (1 species)
  7. 721037Species Streptomyces lavendulae [TaxId:1914] [75395] (4 PDB entries)
  8. 721040Domain d2a4xa1: 2a4x A:3-129 [126166]
    automatically matched to d1kmza_
    complexed with blm

Details for d2a4xa1

PDB Entry: 2a4x (more details), 1.4 Å

PDB Description: Crystal Structure Of Mitomycin C-Binding Protein Complexed with Metal-Free Bleomycin A2
PDB Compounds: (A:) mitomycin-binding protein

SCOP Domain Sequences for d2a4xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a4xa1 d.32.1.2 (A:3-129) Mitomycin resistance protein D, MRD {Streptomyces lavendulae [TaxId: 1914]}
arislfavvvedmakslefyrklgveipaeadsaphteavldggirlawdtvetvrsydp
ewqaptgghrfaiafefpdtasvdkkyaelvdagyeghlkpwnavwgqryaivkdpdgnv
vdlfapl

SCOP Domain Coordinates for d2a4xa1:

Click to download the PDB-style file with coordinates for d2a4xa1.
(The format of our PDB-style files is described here.)

Timeline for d2a4xa1: