Lineage for d2a4va1 (2a4v A:59-214)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 698982Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 698983Superfamily c.47.1: Thioredoxin-like [52833] (22 families) (S)
  5. 699806Family c.47.1.10: Glutathione peroxidase-like [52901] (28 proteins)
  6. 699953Protein Peroxiredoxin dot5 [142387] (1 species)
  7. 699954Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [142388] (1 PDB entry)
  8. 699955Domain d2a4va1: 2a4v A:59-214 [126163]
    mutant

Details for d2a4va1

PDB Entry: 2a4v (more details), 1.8 Å

PDB Description: crystal structure of a truncated mutant of yeast nuclear thiol peroxidase
PDB Compounds: (A:) Peroxiredoxin DOT5

SCOP Domain Sequences for d2a4va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a4va1 c.47.1.10 (A:59-214) Peroxiredoxin dot5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dvneleigdpipdlsllnedndsislkkitennrvvvffvyprastpgstrqasgfrdny
qelkeyaavfglsadsvtsqkkfqskqnlpyhllsdpkrefigllgakktplsgsirshf
ifvdgklkfkrvkispevsvndakkevlevaekfke

SCOP Domain Coordinates for d2a4va1:

Click to download the PDB-style file with coordinates for d2a4va1.
(The format of our PDB-style files is described here.)

Timeline for d2a4va1: