Lineage for d2a4ta_ (2a4t A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2152584Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2152585Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2153717Family d.2.1.3: Phage lysozyme [53981] (4 protein domains)
  6. 2153723Protein Phage T4 lysozyme [53982] (1 species)
  7. 2153724Species Bacteriophage T4 [TaxId:10665] [53983] (568 PDB entries)
    Uniprot P00720
    many mutant structures
  8. 2153870Domain d2a4ta_: 2a4t A: [126162]
    automated match to d1zura1
    complexed with azi, cl, hed, r7a

Details for d2a4ta_

PDB Entry: 2a4t (more details), 1.7 Å

PDB Description: Crystal structure of spin labeled T4 Lysozyme (V131R7)
PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d2a4ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a4ta_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwdeaacnlaksrwynqtpnrakrvittfrtgtwdayknl

SCOPe Domain Coordinates for d2a4ta_:

Click to download the PDB-style file with coordinates for d2a4ta_.
(The format of our PDB-style files is described here.)

Timeline for d2a4ta_: