SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2a4ta_ (2a4t A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2152584Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2152585Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2153717Family d.2.1.3: Phage lysozyme [53981] (4 protein domains)
  6. 2153723Protein Phage T4 lysozyme [53982] (1 species)
  7. 2153724Species Bacteriophage T4 [TaxId:10665] [53983] (560 PDB entries)
    Uniprot P00720
    many mutant structures
  8. 2153870Domain d2a4ta_: 2a4t A: [126162]
    automated match to d1zura1
    complexed with azi, cl, hed, r7a

Details for d2a4ta_

PDB Entry: 2a4t (more details), 1.7 Å

PDB Description: Crystal structure of spin labeled T4 Lysozyme (V131R7)
PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d2a4ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a4ta_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwdeaacnlaksrwynqtpnrakrvittfrtgtwdayknl

SCOPe Domain Coordinates for d2a4ta_:

Click to download the PDB-style file with coordinates for d2a4ta_.
(The format of our PDB-style files is described here.)

Timeline for d2a4ta_: