Lineage for d2a4na1 (2a4n A:1-180)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730983Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 730984Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (9 families) (S)
  5. 730985Family d.108.1.1: N-acetyl transferase, NAT [55730] (56 proteins)
  6. 731000Protein Aminoglycoside 6'-N-acetyltransferase [55731] (1 species)
  7. 731001Species Enterococcus faecium [TaxId:1352] [55732] (3 PDB entries)
  8. 731006Domain d2a4na1: 2a4n A:1-180 [126159]
    automatically matched to d1b87a_
    complexed with coa, so4

Details for d2a4na1

PDB Entry: 2a4n (more details), 2.2 Å

PDB Description: crystal structure of aminoglycoside 6'-n-acetyltransferase complexed with coenzyme a
PDB Compounds: (A:) aac(6')-Ii

SCOP Domain Sequences for d2a4na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a4na1 d.108.1.1 (A:1-180) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]}
miisefdrnnpvlkdqlsdllrltwpeeygdssaeeveemmnperiavaavdqdelvgfi
gaipqygitgwelhplvvessrrknqigtrlvnylekevasrggitiylgtddldhgttl
sqtdlyehtfdkvasiqnlrehpyefyeklgykivgvlpnangwdkpdiwmaktiiprpd

SCOP Domain Coordinates for d2a4na1:

Click to download the PDB-style file with coordinates for d2a4na1.
(The format of our PDB-style files is described here.)

Timeline for d2a4na1: